COX19_HUMAN   Q49B96


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q49B96

Recommended name:Cytochrome c oxidase assembly protein COX19

EC number:

Alternative names:(hCOX19)

Cleaved into:

GeneID:90639

Gene names  (primary ):COX19

Gene names  (synonym ):

Gene names  (ORF ):

Length:90

Mass:10394

Sequence:MSTAMNFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKCLHNNNFENALCRKESKEYLECRMERKLMLQEPLEKLGFGDLTSGKSEAKK

Tissue specificity:Ubiquitously expressed. Highly expressed in skeletal muscle. {ECO:0000269|PubMed:16212937}.

Induction:

Developmental stage:

Protein families:COX19 family


   💬 WhatsApp