COX16_HUMAN   Q9P0S2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9P0S2

Recommended name:Cytochrome c oxidase assembly protein COX16 homolog, mitochondrial

EC number:

Alternative names:(hCOX16)

Cleaved into:

GeneID:51241

Gene names  (primary ):COX16

Gene names  (synonym ):C14orf112

Gene names  (ORF ):HSPC203 PTD019

Length:106

Mass:12293

Sequence:MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKIKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT

Tissue specificity:Widely expressed. Expressed at higher level in skeletal muscle, heart and liver. {ECO:0000269|PubMed:29355485}.

Induction:

Developmental stage:

Protein families:COX16 family


   💬 WhatsApp