CD83_HUMAN Q01151
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q01151
Recommended name:CD83 antigen
EC number:
Alternative names:(hCD83) (B-cell activation protein) (Cell surface protein HB15) (CD antigen CD83)
Cleaved into:
GeneID:9308
Gene names (primary ):CD83
Gene names (synonym ):
Gene names (ORF ):
Length:205
Mass:23042
Sequence:MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV
Tissue specificity:Expressed by activated lymphocytes, Langerhans cells and interdigitating reticulum cells.
Induction:
Developmental stage:
Protein families: