H2B2C_HUMAN   Q6DN03


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6DN03

Recommended name:Putative histone H2B type 2-C

EC number:

Alternative names:(H2B-clustered histone 20 pseudogene) (Histone H2B.t) (H2B/t)

Cleaved into:

GeneID:

Gene names  (primary ):H2BC20P

Gene names  (synonym ):HIST2H2BC

Gene names  (ORF ):

Length:193

Mass:21472

Sequence:MPEPAKFAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKRVHPDTGIWCKAMGIMNSFLNDIFERIAGEASRLAHYNKRSTITSRRSRRPCACCCPASWPSTPCPRAPRRSPSTPAPSESLPGPGARSLPPSLPPRVAGCFVSKGSFQGHLTTSVKESFLCCQSQLMFLASRLVNFRRAHNTKHR

Tissue specificity:

Induction:

Developmental stage:

Protein families:Histone H2B family


   💬 WhatsApp