H2B1O_HUMAN P23527
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P23527
Recommended name：Histone H2B type 1-O
EC number：
Alternative names：(H2B-clustered histone 17) (Histone H2B.2) (Histone H2B.n) (H2B/n)
Cleaved into：
GeneID：8348
Gene names (primary )：H2BC17
Gene names (synonym )：H2BFH H2BFN HIST1H2BO
Gene names (ORF )：
Length：126
Mass：13906
Sequence：MPDPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Tissue specificity：
Induction：
Developmental stage：
Protein families：Histone H2B family