H2BWT_HUMAN Q7Z2G1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7Z2G1
Recommended name：Histone H2B type W-T
EC number：
Alternative names：(H2B histone family member W testis-specific) (H2B.W histone 1)
Cleaved into：
GeneID：158983
Gene names (primary )：H2BW1
Gene names (synonym )：H2BFWT
Gene names (ORF )：
Length：175
Mass：19618
Sequence：MLRTEVPRLPRSTTAIVWSCHLMATASAMAGPSSETTSEEQLITQEPKEANSTTSQKQSKQRKRGRHGPRRCHSNCRGDSFATYFRRVLKQVHQGLSLSREAVSVMDSLVHDILDRIATEAGRLARSTKRQTITAWETRMAVRLLLPGQMGKLAESEGTKAVLRTSLYAIQQQRK
Tissue specificity：Testis-specific. Present in sperm cells (at protein level). {ECO:0000269|PubMed:15475252}.
Induction：
Developmental stage：
Protein families：Histone H2B family