H2A2B_HUMAN   Q8IUE6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8IUE6

Recommended name:Histone H2A type 2-B

EC number:

Alternative names:(H2A-clustered histone 21)

Cleaved into:

GeneID:317772

Gene names  (primary ):H2AC21

Gene names  (synonym ):HIST2H2AB

Gene names  (ORF ):

Length:130

Mass:13995

Sequence:MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTESHKPGKNK

Tissue specificity:

Induction:

Developmental stage:

Protein families:Histone H2A family


   💬 WhatsApp