H2A1H_HUMAN   Q96KK5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96KK5

Recommended name:Histone H2A type 1-H

EC number:

Alternative names:(H2A-clustered histone 12) (Histone H2A/s)

Cleaved into:

GeneID:85235

Gene names  (primary ):H2AC12

Gene names  (synonym ):HIST1H2AH HIST1H2AI

Gene names  (ORF ):

Length:128

Mass:13906

Sequence:MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAK

Tissue specificity:

Induction:

Developmental stage:

Protein families:Histone H2A family


   💬 WhatsApp