H2AZ_HUMAN   P0C0S5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0C0S5

Recommended name:Histone H2A.Z

EC number:

Alternative names:(H2A/z)

Cleaved into:

GeneID:3015

Gene names  (primary ):H2AZ1

Gene names  (synonym ):H2AFZ H2AZ

Gene names  (ORF ):

Length:128

Mass:13553

Sequence:MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV

Tissue specificity:

Induction:

Developmental stage:

Protein families:Histone H2A family


   💬 WhatsApp