H2AB1_HUMAN   P0C5Y9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0C5Y9

Recommended name:Histone H2A-Bbd type 1

EC number:

Alternative names:(H2A Barr body-deficient) (H2A.B) (H2A.Bbd)

Cleaved into:

GeneID:474382

Gene names  (primary ):H2AB1

Gene names  (synonym ):H2AFB1

Gene names  (ORF ):

Length:115

Mass:12697

Sequence:MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVPELAGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED

Tissue specificity:Present in mature sperm. {ECO:0000269|PubMed:20008104}.

Induction:

Developmental stage:

Protein families:Histone H2A family


   💬 WhatsApp