HILS1_HUMAN   P60008


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P60008

Recommended name:Putative spermatid-specific linker histone H1-like protein

EC number:

Alternative names:(H1.9 linker histone pseudogene)

Cleaved into:

GeneID:

Gene names  (primary ):H1-9P

Gene names  (synonym ):H1-9 HILS1

Gene names  (ORF ):

Length:231

Mass:25632

Sequence:MLHASTIWHLRSTPPRRKQWGHCDPHRILVASEVTTEITSPTPAPRAQVCGGQPWVTVLDPLSGHTGREAERHFATVSISAVELKYCHGWRPAGQRVPSKTATGQRTCAKPCQKPSTSKVILRAVADKGTCKYVSLATLKKAVSTTGYDMARNAYHFKRVLKGLVDKGSAGSFTLGKKQASKSKLKVKRQRQQRWRSGQRPFGQHRSLLGSKQGHKRLIKGVRRVAKCHCN

Tissue specificity:Expressed exclusively in the testis. {ECO:0000269|PubMed:12920187}.

Induction:

Developmental stage:

Protein families:Histone H1/H5 family


   💬 WhatsApp