GUC2A_HUMAN   Q02747


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q02747

Recommended name:Guanylin

EC number:

Alternative names:(Guanylate cyclase activator 2A) (Guanylate cyclase-activating protein 1) (Guanylate cyclase-activating protein I) (GCAP-I)

Cleaved into:HMW-guanylin; Guanylin

GeneID:2980

Gene names  (primary ):GUCA2A

Gene names  (synonym ):GUCA2

Gene names  (ORF ):

Length:115

Mass:12388

Sequence:MNAFLLSALCLLGAWAALAGGVTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC

Tissue specificity:Highly expressed in ileum and colon. Found in plasma.

Induction:

Developmental stage:

Protein families:Guanylin family


   💬 WhatsApp