RAB35_HUMAN Q15286
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q15286
Recommended name:Ras-related protein Rab-35
EC number:
Alternative names:(GTP-binding protein RAY) (Ras-related protein Rab-1C)
Cleaved into:
GeneID:11021
Gene names (primary ):RAB35
Gene names (synonym ):RAB1C RAY
Gene names (ORF ):
Length:201
Mass:23025
Sequence:MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC
Tissue specificity:
Induction:
Developmental stage:
Protein families:Small GTPase superfamily, Rab family