PPR17_HUMAN O96001
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O96001
Recommended name：Protein phosphatase 1 regulatory subunit 17
EC number：
Alternative names：(G-substrate)
Cleaved into：
GeneID：10842
Gene names (primary )：PPP1R17
Gene names (synonym )：C7orf16 GSBS
Gene names (ORF )：
Length：155
Mass：17866
Sequence：MMSTEQMQPLELSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALHIPPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMSPFAAGVTLLRDERPKAIVEDDEKDGDKIAI
Tissue specificity：Highly expressed in cerebellum.
Induction：
Developmental stage：
Protein families：