GSTO1_HUMAN   P78417


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P78417

Recommended name:Glutathione S-transferase omega-1

EC number:EC:2.5.1.18

Alternative names:(GSTO-1) (Glutathione S-transferase omega 1-1) (GSTO 1-1) (Glutathione-dependent dehydroascorbate reductase) (Monomethylarsonic acid reductase) (MMA(V) reductase) (S-(Phenacyl)glutathione reductase) (SPG-R)

Cleaved into:

GeneID:9446

Gene names  (primary ):GSTO1

Gene names  (synonym ):GSTTLP28

Gene names  (ORF ):

Length:241

Mass:27566

Sequence:MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL

Tissue specificity:Ubiquitous. Highest expression in liver, pancreas, skeletal muscle, spleen, thymus, colon, blood leukocyte and heart. Lowest expression in brain, placenta and lung. {ECO:0000269|PubMed:10783391}.

Induction:

Developmental stage:

Protein families:GST superfamily, Omega family


   💬 WhatsApp