PG12B_HUMAN   Q9BX93


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BX93

Recommended name:Group XIIB secretory phospholipase A2-like protein

EC number:

Alternative names:(Group XIII secretory phospholipase A2-like protein) (GXIII sPLA2-like) (sPLA2-GXIIB) (GXIIB)

Cleaved into:

GeneID:84647

Gene names  (primary ):PLA2G12B

Gene names  (synonym ):PLA2G13

Gene names  (ORF ):FKSG71

Length:195

Mass:21659

Sequence:MKLASGFLVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGKNGVCQYRCRYGKAPMPRPGYKPQEPNGCGSYFLGLKVPESMDLGIPAMTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSICSDLKRSLGFVSKVEAACDSLVDTVFNTVWTLGCRPFMNSQRAACICAEEEKEEL

Tissue specificity:Strong expression in liver, small intestine and kidney. {ECO:0000269|PubMed:14516201}.

Induction:

Developmental stage:

Protein families:Phospholipase A2 family


   💬 WhatsApp