CXCL3_HUMAN   P19876


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P19876

Recommended name:C-X-C motif chemokine 3

EC number:

Alternative names:(GRO-gamma(1-73)) (Growth-regulated protein gamma) (GRO-gamma) (Macrophage inflammatory protein 2-beta) (MIP2-beta)

Cleaved into:GRO-gamma(5-73)

GeneID:2921

Gene names  (primary ):CXCL3

Gene names  (synonym ):GRO3 GROG SCYB3

Gene names  (ORF ):

Length:107

Mass:11342

Sequence:MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN

Tissue specificity:

Induction:

Developmental stage:

Protein families:Intercrine alpha (chemokine CxC) family


   💬 WhatsApp