GPX2_HUMAN   P18283


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P18283

Recommended name:Glutathione peroxidase 2

EC number:EC:1.11.1.9

Alternative names:(GPx-2) (GSHPx-2) (Gastrointestinal glutathione peroxidase) (Glutathione peroxidase-gastrointestinal) (GPx-GI) (GSHPx-GI) (Glutathione peroxidase-related protein 2) (GPRP-2)

Cleaved into:

GeneID:2877

Gene names  (primary ):GPX2

Gene names  (synonym ):

Gene names  (ORF ):

Length:190

Mass:21954

Sequence:MAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLKVAI

Tissue specificity:Mostly in liver and gastrointestinal tract, not found in heart or kidney.

Induction:

Developmental stage:

Protein families:Glutathione peroxidase family


   💬 WhatsApp