OPN5_HUMAN Q6U736
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6U736
Recommended name：Opsin-5
EC number：
Alternative names：(G-protein coupled receptor 136) (G-protein coupled receptor PGR12) (Neuropsin) (Transmembrane protein 13)
Cleaved into：
GeneID：221391
Gene names (primary )：OPN5
Gene names (synonym )：GPR136 PGR12 TMEM13
Gene names (ORF )：
Length：354
Mass：39727
Sequence：MALNHTALPQDERLPHYLRDGDPFASKLSWEADLVAGFYLTIIGILSTFGNGYVLYMSSRRKKKLRPAEIMTINLAVCDLGISVVGKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICYLSYGVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFGTSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMKLTKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYKFACCQTGGLKATKKKSLEGFRLHTVTTVRKSSAVLEIHEEWE
Tissue specificity：Detected in brain and retina and cell lines derived from neural retina. {ECO:0000269|PubMed:14623103}.
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family, Opsin subfamily