HCAR3_HUMAN P49019
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P49019
Recommended name：Hydroxycarboxylic acid receptor 3
EC number：
Alternative names：(G-protein coupled receptor 109B) (G-protein coupled receptor HM74) (G-protein coupled receptor HM74B) (Niacin receptor 2) (Nicotinic acid receptor 2)
Cleaved into：
GeneID：8843
Gene names (primary )：HCAR3
Gene names (synonym )：GPR109B HCA3 HM74B NIACR2
Gene names (ORF )：
Length：387
Mass：44478
Sequence：MNRHHLQDHFLEIDKKNCCVFRDDFIAKVLPPVLGLEFIFGLLGNGLALWIFCFHLKSWKSSRIFLFNLAVADFLLIICLPFVMDYYVRRSDWKFGDIPCRLVLFMFAMNRQGSIIFLTVVAVDRYFRVVHPHHALNKISNWTAAIISCLLWGITVGLTVHLLKKKLLIQNGTANVCISFSICHTFRWHEAMFLLEFFLPLGIILFCSARIIWSLRQRQMDRHAKIKRAITFIMVVAIVFVICFLPSVVVRIHIFWLLHTSGTQNCEVYRSVDLAFFITLSFTYMNSMLDPVVYYFSSPSFPNFFSTLINRCLQRKITGEPDNNRSTSVELTGDPNKTRGAPEALIANSGEPWSPSYLGPTSNNHSKKGHCHQEPASLEKQLGCCIE
Tissue specificity：Expression largely restricted to adipose tissue and spleen. {ECO:0000269|PubMed:12522134}.
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family