G32P1_HUMAN   Q8NGA4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8NGA4

Recommended name:Putative G-protein coupled receptor GPR32P1

EC number:

Alternative names:(G-protein coupled 32 pseudogene) (G-protein coupled 32 pseudogene 1) (G-protein coupled receptor GPCR39) (hGPCR39)

Cleaved into:

GeneID:

Gene names  (primary ):GPR32P1

Gene names  (synonym ):

Gene names  (ORF ):

Length:272

Mass:30291

Sequence:MNGVSEGTRGCSDRQPGALTQGHSCSRKMNASRCLSEEVGSLRPLTMAVLSASFVVGVLGNGLVPWVTVFRMARTVSTVCFFHLALADFMLSLSLPILVYYIVSRQWLLGEWACKLYTGFVFLTFSTSNCLLVLISVDRCISVLYPVWALNHRTEQRASWLAFGVWLLAAALCSAHLKFRTTRKWNGCMQCYLQFNLENETAQMWTQEVFGRQMAVIMAHFLLGFLGPLAIIGTCAHLIRAKLLREGWVHANRPKRLLLVLVSALSAGSHLT

Tissue specificity:

Induction:

Developmental stage:

Protein families:G-protein coupled receptor 1 family


   💬 WhatsApp