GOGA7_HUMAN Q7Z5G4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7Z5G4
Recommended name：Golgin subfamily A member 7
EC number：
Alternative names：(Golgi complex-associated protein of 16 kDa)
Cleaved into：
GeneID：51125
Gene names (primary )：GOLGA7
Gene names (synonym )：GCP16
Gene names (ORF )：HDCKB03P HSPC041
Length：137
Mass：15824
Sequence：MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR
Tissue specificity：Expressed in all tissues except colon and thymus. {ECO:0000269|PubMed:14522980, ECO:0000269|PubMed:16000296}.
Induction：
Developmental stage：
Protein families：ERF4 family