LFG4_HUMAN   Q9HC24


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9HC24

Recommended name:Protein lifeguard 4

EC number:

Alternative names:(Golgi anti-apoptotic protein) (Protein S1R) (Transmembrane BAX inhibitor motif-containing protein 4) (Z-protein)

Cleaved into:

GeneID:51643

Gene names  (primary ):TMBIM4

Gene names  (synonym ):GAAP LFG4

Gene names  (ORF ):CGI-119

Length:238

Mass:26971

Sequence:MADPDPRYPRSSIEDDFNYGSSVASATVHIRMAFLRKVYSILSLQVLLTTVTSTVFLYFESVRTFVHESPALILLFALGSLGLIFALILNRHKYPLNLYLLFGFTLLEALTVAVVVTFYDVYIILQAFILTTTVFFGLTVYTLQSKKDFSKFGAGLFALLWILCLSGFLKFFFYSEIMELVLAAAGALLFCGFIIYDTHSLMHKLSPEEYVLAAISLYLDIINLFLHLLRFLEAVNKK

Tissue specificity:

Induction:

Developmental stage:

Protein families:BI1 family, LFG subfamily


   💬 WhatsApp