LAP4A_HUMAN   Q15012


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q15012

Recommended name:Lysosomal-associated transmembrane protein 4A

EC number:

Alternative names:(Golgi 4-transmembrane-spanning transporter MTP)

Cleaved into:

GeneID:9741

Gene names  (primary ):LAPTM4A

Gene names  (synonym ):KIAA0108 LAPTM4 MBNT MTRP

Gene names  (ORF ):UNQ1846/PRO3574

Length:233

Mass:26801

Sequence:MVSMSFKRNRSDRFYSTRCCGCCHVRTGTIILGTWYMVVNLLMAILLTVEVTHPNSMPAVNIQYEVIGNYYSSERMADNACVLFAVSVLMFIISSMLVYGAISYQVGWLIPFFCYRLFDFVLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFALFIIFKAYLINCVWNCYKYINNRNVPEIAVYPAFEAPPQYVLPTYEMAVKMPEKEPPPPYLPA

Tissue specificity:

Induction:

Developmental stage:

Protein families:LAPTM4/LAPTM5 transporter family


   💬 WhatsApp