GLYG_HUMAN   P46976


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P46976

Recommended name:Glycogenin-1

EC number:EC:2.4.1.186

Alternative names:(GN-1) (GN1)

Cleaved into:

GeneID:2992

Gene names  (primary ):GYG1

Gene names  (synonym ):GYG

Gene names  (ORF ):

Length:350

Mass:39384

Sequence:MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVLSDLVYTLAFSCGFCRKEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ

Tissue specificity:Highly expressed in skeletal muscle and heart, with lower levels in brain, lung, kidney and pancreas. {ECO:0000269|PubMed:8602861}.

Induction:

Developmental stage:

Protein families:Glycosyltransferase 8 family, Glycogenin subfamily


   💬 WhatsApp