PA2GF_HUMAN Q9BZM2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BZM2
Recommended name：Group IIF secretory phospholipase A2
EC number：EC:3.1.1.4
Alternative names：(GIIF sPLA2) (sPLA2-IIF) (Phosphatidylcholine 2-acylhydrolase 2F)
Cleaved into：
GeneID：64600
Gene names (primary )：PLA2G2F
Gene names (synonym )：
Gene names (ORF )：
Length：168
Mass：18658
Sequence：MKKFFTVAILAGSVLSTAHGSLLNLKAMVEAVTGRSAILSFVGYGCYCGLGGRGQPKDEVDWCCHAHDCCYQELFDQGCHPYVDHYDHTIENNTEIVCSDLNKTECDKQTCMCDKNMVLCLMNQTYREEYRGFLNVYCQGPTPNCSIYEPPPEEVTCSHQSPAPPAPP
Tissue specificity：Expressed at high levels in placenta, testis, thymus and at lower levels in heart, kidney, liver and prostate (PubMed:11112443). Highly expressed in rheumatoid arthritic tissues, including synovial lining cells in the intima, capillary endothelial cells and plasma cells (PubMed:11877435). {ECO:0000269|PubMed:11112443, ECO:0000269|PubMed:11877435}.
Induction：
Developmental stage：
Protein families：Phospholipase A2 family