GOT1B_HUMAN   Q9Y3E0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y3E0

Recommended name:Vesicle transport protein GOT1B

EC number:

Alternative names:(Germ cell tumor 2) (Golgi transport 1 homolog B) (Putative NF-kappa-B-activating protein 470) (hGOT1a)

Cleaved into:

GeneID:51026

Gene names  (primary ):GOLT1B

Gene names  (synonym ):GCT2 GOT1A

Gene names  (ORF ):CGI-141 HDCMA39P UNQ432/PRO793

Length:138

Mass:15426

Sequence:MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFFQKHKMKATGFFLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLNLPGIRSFVDKVGESNNMV

Tissue specificity:Widely expressed. Tends to be up-regulated in seminomas compared to normal testis. {ECO:0000269|PubMed:12414650}.

Induction:

Developmental stage:

Protein families:GOT1 family


   💬 WhatsApp