CSF3_HUMAN   P09919


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P09919

Recommended name:Granulocyte colony-stimulating factor

EC number:

Alternative names:(G-CSF) (Pluripoietin) (Filgrastim) (Lenograstim)

Cleaved into:

GeneID:1440

Gene names  (primary ):CSF3

Gene names  (synonym ):C17orf33 GCSF

Gene names  (ORF ):

Length:207

Mass:22293

Sequence:MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Tissue specificity:

Induction:

Developmental stage:

Protein families:IL-6 superfamily


   💬 WhatsApp