GUC1B_HUMAN   Q9UMX6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UMX6

Recommended name:Guanylyl cyclase-activating protein 2

EC number:

Alternative names:(GCAP 2) (Guanylate cyclase activator 1B)

Cleaved into:

GeneID:2979

Gene names  (primary ):GUCA1B

Gene names  (synonym ):GCAP2

Gene names  (ORF ):

Length:200

Mass:23420

Sequence:MGQEFSWEEAEAAGEIDVAELQEWYKKFVMECPSGTLFMHEFKRFFKVTDDEEASQYVEGMFRAFDKNGDNTIDFLEYVAALNLVLRGTLEHKLKWTFKIYDKDGNGCIDRLELLNIVEGIYQLKKACRRELQTEQGQLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKMLQMDMNPSSWLAQQRRKSAMF

Tissue specificity:In the retina, it is expressed in cone and rod photoreceptor cells. {ECO:0000269|PubMed:9620085}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp