GUC1A_HUMAN   P43080


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P43080

Recommended name:Guanylyl cyclase-activating protein 1

EC number:

Alternative names:(GCAP 1) (Guanylate cyclase activator 1A)

Cleaved into:

GeneID:118142757

Gene names  (primary ):GUCA1A

Gene names  (synonym ):C6orf131 GCAP GCAP1 GUCA1

Gene names  (ORF ):

Length:201

Mass:22920

Sequence:MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAG

Tissue specificity:In the retina, it is expressed in rod and cone photoreceptors. {ECO:0000269|PubMed:9620085}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp