PP14D_HUMAN Q9NXH3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NXH3
Recommended name：Protein phosphatase 1 regulatory subunit 14D
EC number：
Alternative names：(Gastrointestinal and brain-specific PP1-inhibitory protein 1) (GBPI-1)
Cleaved into：
GeneID：54866
Gene names (primary )：PPP1R14D
Gene names (synonym )：GBPI
Gene names (ORF )：
Length：145
Mass：16508
Sequence：MLSSSPASCTSPSPDGENPCKKVHWASGRRRTSSTDSESKSHPDSSKIPRSRRPSRLTVKYDRGQLQRWLEMEQWVDAQVQELFQDQATPSEPEIDLEALMDLSTEEQKTQLEAILGNCPRPTEAFISELLSQLKKLRRLSRPQK
Tissue specificity：Detected in colon, intestine, kidney and brain cortex. {ECO:0000269|PubMed:12974676}.
Induction：
Developmental stage：
Protein families：PP1 inhibitor family