SERF2_HUMAN   P84101


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P84101

Recommended name:Small EDRK-rich factor 2

EC number:

Alternative names:(Gastric cancer-related protein VRG107) (Protein 4F5-related) (4F5rel) (h4F5rel)

Cleaved into:

GeneID:10169

Gene names  (primary ):SERF2

Gene names  (synonym ):FAM2C

Gene names  (ORF ):

Length:59

Mass:6900

Sequence:MTRGNQRELARQKNMKKQSDSVKGKRRDDGLSAAARKQRDSEIMQQKQKKANEKKEEPK

Tissue specificity:

Induction:

Developmental stage:

Protein families:SERF family


   💬 WhatsApp