TXNG2_HUMAN   Q9BZA5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BZA5

Recommended name:Putative gamma-taxilin 2

EC number:

Alternative names:(Gamma-taxilin 2 pseudogene) (Taxilin gamma pseudogene, Y-linked)

Cleaved into:

GeneID:

Gene names  (primary ):TXLNGY

Gene names  (synonym ):CYorf15A CYorf15B TXLNG2P

Gene names  (ORF ):

Length:131

Mass:14632

Sequence:MEEAGLCGLREKADMLCNSESHDILQHQDSNCSATSNKHLLEDEEGRDFITKNRSWVSPVHCTQESRRELPEQEVAPPSGQQALQCNRNKEKVLGKEVLLLMQALNTLSTPEEKLAALCKKYADLGNSPLL

Tissue specificity:Ubiquitously expressed. {ECO:0000269|PubMed:12815422, ECO:0000269|Ref.1}.

Induction:

Developmental stage:

Protein families:Taxilin family


   💬 WhatsApp