GGTL2_HUMAN   Q14390


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q14390

Recommended name:Glutathione hydrolase light chain 2

EC number:

Alternative names:(Gamma-glutamyltransferase light chain 2) (Gamma-glutamyltransferase-like protein 4)

Cleaved into:

GeneID:91227

Gene names  (primary ):GGTLC2

Gene names  (synonym ):GGTL4

Gene names  (ORF ):

Length:218

Mass:23661

Sequence:MTSEFFAAQLRAQISDDTTHPISYYKPEFYTPVDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSEILFNDEMDDFSSPNITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQPPSHADHTPMPQAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY

Tissue specificity:Placenta and sigmoid tissues.

Induction:

Developmental stage:

Protein families:Gamma-glutamyltransferase family


   💬 WhatsApp