ANFB_HUMAN   P16860


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P16860

Recommended name:Natriuretic peptides B

EC number:

Alternative names:(Gamma-brain natriuretic peptide)

Cleaved into:Brain natriuretic peptide 32 (BNP(1-32)) (BNP-32); BNP(1-30); BNP(1-29); BNP(1-28); BNP(2-31); BNP(3-32); BNP(3-30); BNP(3-29); BNP(4-32); BNP(4-31); BNP(4-30); BNP(4-29); BNP(4-27); BNP(5-32); BNP(5-31); BNP(5-29)

GeneID:4879

Gene names  (primary ):NPPB

Gene names  (synonym ):

Gene names  (ORF ):

Length:134

Mass:14726

Sequence:MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Tissue specificity:Brain and also in atria, but at much lower levels than ANP.

Induction:

Developmental stage:

Protein families:Natriuretic peptide family


   💬 WhatsApp