LEGL_HUMAN   Q3ZCW2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3ZCW2

Recommended name:Galectin-related protein

EC number:

Alternative names:(Galectin-like protein) (Lectin galactoside-binding-like protein)

Cleaved into:

GeneID:29094

Gene names  (primary ):LGALSL

Gene names  (synonym ):GRP

Gene names  (ORF ):HSPC159

Length:172

Mass:18986

Sequence:MAGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLG

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp