GAGE7_HUMAN   O76087


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O76087

Recommended name:G antigen 7

EC number:

Alternative names:(GAGE-7) (AL4) (Cancer/testis antigen 4.7) (CT4.7) (GAGE-12I) (GAGE-7B) (GAGE-8)

Cleaved into:

GeneID:100008586

Gene names  (primary ):GAGE7

Gene names  (synonym ):GAGE12I GAGE7B

Gene names  (ORF ):

Length:117

Mass:12978

Sequence:MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Tissue specificity:Expressed in some prostate cancer tissues but not in normal prostate tissue.

Induction:

Developmental stage:

Protein families:GAGE family


   💬 WhatsApp