GAGE5_HUMAN   Q13069


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q13069

Recommended name:G antigen 5

EC number:

Alternative names:(GAGE-5) (Cancer/testis antigen 4.5) (CT4.5)

Cleaved into:

GeneID:2576

Gene names  (primary ):GAGE5

Gene names  (synonym ):

Gene names  (ORF ):

Length:117

Mass:12924

Sequence:MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Tissue specificity:Expressed in a variety of tumor tissues but not in normal tissues, except testis.

Induction:

Developmental stage:

Protein families:GAGE family


   💬 WhatsApp