GGE2D_HUMAN   Q9UEU5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UEU5

Recommended name:G antigen 2D

EC number:

Alternative names:(GAGE-2D) (Cancer/testis antigen 4.8) (CT4.8) (G antigen 8) (GAGE-8)

Cleaved into:

GeneID:100101629

Gene names  (primary ):GAGE2D; GAGE8

Gene names  (synonym ):;

Gene names  (ORF ):;

Length:116

Mass:12764

Sequence:MSWRGRSTYRPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Tissue specificity:Not expressed in normal tissues, except in testis, but expressed by a large proportion of tumors of various histological origins.

Induction:

Developmental stage:

Protein families:GAGE family


   💬 WhatsApp