GG12C_HUMAN   A1L429


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A1L429

Recommended name:G antigen 12B/C/D/E

EC number:

Alternative names:(GAGE-12B) (GAGE-12C) (GAGE-12D) (GAGE-12E)

Cleaved into:

GeneID:100132399

Gene names  (primary ):GAGE12B; GAGE12C; GAGE12D; GAGE12E

Gene names  (synonym ):; ; ;

Gene names  (ORF ):; ; ;

Length:117

Mass:12925

Sequence:MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQCQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Tissue specificity:

Induction:

Developmental stage:

Protein families:GAGE family


   💬 WhatsApp