GBRL3_HUMAN   Q9BY60


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BY60

Recommended name:Gamma-aminobutyric acid receptor-associated protein-like 3

EC number:

Alternative names:(GABA(A) receptor-associated protein-like 3)

Cleaved into:

GeneID:

Gene names  (primary ):GABARAPL3

Gene names  (synonym ):

Gene names  (ORF ):

Length:117

Mass:13976

Sequence:MKFQYKEVHPFEYRKKEGEKIRKKYPDRVPLIVEKAPKARVPDLDRRKYLVPSDLTDGQFYLLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDSHEEDDFLYVAYSNESVYGK

Tissue specificity:Ubiquitous. Expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta and skeletal muscle. Expressed at very low levels in thymus and small intestine. {ECO:0000269|PubMed:11414770}.

Induction:

Developmental stage:

Protein families:ATG8 family


   💬 WhatsApp