IGLL5_HUMAN   B9A064


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:B9A064

Recommended name:Immunoglobulin lambda-like polypeptide 5

EC number:

Alternative names:(G lambda-1) (Germline immunoglobulin lambda 1)

Cleaved into:

GeneID:100423062

Gene names  (primary ):IGLL5

Gene names  (synonym ):

Gene names  (ORF ):

Length:214

Mass:23063

Sequence:MRPKTGQVGCETPEELGPGPRQRWPLLLLGLAMVAHGLLRPMVAPQSGDPDPGASVGSSRSSLRSLWGRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Tissue specificity:Contrary to IGLL1, not expressed in pre-B-cells. {ECO:0000269|PubMed:1703205, ECO:0000269|PubMed:1900243}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp