M4A8_HUMAN Q9BY19
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BY19
Recommended name：Membrane-spanning 4-domains subfamily A member 8
EC number：
Alternative names：(Four-span transmembrane protein 4) (Membrane-spanning 4-domains subfamily A member 8B)
Cleaved into：
GeneID：83661
Gene names (primary )：MS4A8
Gene names (synonym )：4SPAN4 MS4A8B
Gene names (ORF )：
Length：250
Mass：26290
Sequence：MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGKTLGAIQIIIGLAHIGLGSIMATVLVGEYLSISFYGGFPFWGGLWFIISGSLSVAAENQPYSYCLLSGSLGLNIVSAICSAVGVILFITDLSIPHPYAYPDYYPYAWGVNPGMAISGVLLVFCLLEFGIACASSHFGCQLVCCQSSNVSVIYPNIYAANPVITPEPVTSPPSYSSEIQANK
Tissue specificity：Expressed by hematopoietic tissues and cells lines.
Induction：
Developmental stage：
Protein families：MS4A family