FLT3L_HUMAN   P49771


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P49771

Recommended name:Fms-related tyrosine kinase 3 ligand

EC number:

Alternative names:(Flt3 ligand) (Flt3L) (SL cytokine)

Cleaved into:

GeneID:2323

Gene names  (primary ):FLT3LG

Gene names  (synonym ):

Gene names  (ORF ):

Length:235

Mass:26416

Sequence:MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp