YIPF7_HUMAN Q8N8F6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8N8F6
Recommended name:Protein YIPF7
EC number:
Alternative names:(Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 9) (YIP1 family member 7)
Cleaved into:
GeneID:285525
Gene names (primary ):YIPF7
Gene names (synonym ):FINGER9 YIP1B
Gene names (ORF ):
Length:280
Mass:30632
Sequence:MDLLKISHTKLHLLEDLSIKNKQRMSNLAQFDSDFYQSNFTIDNQEQSGNDSNAYGNLYGSRKQQAGEQPQPASFVPSEMLMSSGYAGQFFQPASNSDYYSQSPYIDSFDEEPPLLEELGIHFDHIWQKTLTVLNPMKPVDGSIMNETDLTGPILFCVALGATLLLAGKVQFGYVYGMSAIGCLVIHALLNLMSSSGVSYGCVASVLGYCLLPMVILSGCAMFFSLQGIFGIMSSLVIIGWCSLSASKIFIAALHMEGQQLLVAYPCAILYGLFALLTIF
Tissue specificity:
Induction:
Developmental stage:
Protein families:YIP1 family