OTOR_HUMAN   Q9NRC9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NRC9

Recommended name:Otoraplin

EC number:

Alternative names:(Fibrocyte-derived protein) (Melanoma inhibitory activity-like protein)

Cleaved into:

GeneID:56914

Gene names  (primary ):OTOR

Gene names  (synonym ):FDP MIAL

Gene names  (ORF ):UNQ3054/PRO9873

Length:128

Mass:14332

Sequence:MARILLLFLPGLVAVCAVHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE

Tissue specificity:Highly expressed in cochlea.

Induction:

Developmental stage:

Protein families:MIA/OTOR family


   💬 WhatsApp