FHL2_HUMAN   Q14192


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q14192

Recommended name:Four and a half LIM domains protein 2

EC number:

Alternative names:(FHL-2) (LIM domain protein DRAL) (Skeletal muscle LIM-protein 3) (SLIM-3)

Cleaved into:

GeneID:2274

Gene names  (primary ):FHL2

Gene names  (synonym ):DRAL SLIM3

Gene names  (ORF ):

Length:279

Mass:32193

Sequence:MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI

Tissue specificity:Expressed in skeletal muscle and heart. {ECO:0000269|PubMed:11813260}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp