FGFP3_HUMAN   Q8TAT2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8TAT2

Recommended name:Fibroblast growth factor-binding protein 3

EC number:

Alternative names:(FGF-BP3) (FGF-binding protein 3) (FGFBP-3)

Cleaved into:

GeneID:143282

Gene names  (primary ):FGFBP3

Gene names  (synonym ):C10orf13

Gene names  (ORF ):PSEC0101

Length:258

Mass:27590

Sequence:MTPPKLRASLSPSLLLLLSGCLLAAARREKGAASNVAEPVPGPTGGSSGRFLSPEQHACSWQLLLPAPEAAAGSELALRCQSPDGARHQCAYRGHPERCAAYAARRAHFWKQVLGGLRKKRRPCHDPAPLQARLCAGKKGHGAELRLVPRASPPARPTVAGFAGESKPRARNRGRTRERASGPAAGTPPPQSAPPKENPSERKTNEGKRKAALVPNEERPMGTGPDPDGLDGNAELTETYCAEKWHSLCNFFVNFWNG

Tissue specificity:

Induction:

Developmental stage:

Protein families:Fibroblast growth factor-binding protein family


   💬 WhatsApp