FGFP2_HUMAN   Q9BYJ0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BYJ0

Recommended name:Fibroblast growth factor-binding protein 2

EC number:

Alternative names:(FGF-BP2) (FGF-binding protein 2) (FGFBP-2) (37 kDa killer-specific secretory protein) (Ksp37) (HBp17-related protein) (HBp17-RP)

Cleaved into:

GeneID:83888

Gene names  (primary ):FGFBP2

Gene names  (synonym ):KSP37

Gene names  (ORF ):UNQ425/PRO1065

Length:223

Mass:24581

Sequence:MKFVPCLLLVTLSCLGTLGQAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTYWCEYRGQPSMCQAFAADPKPYWNQALQELRRLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFFRG

Tissue specificity:Expressed in serum, peripheral leukocytes and cytotoxic T-lymphocytes, but not in granulocytes and monocytes (at protein level). {ECO:0000269|PubMed:11342666}.

Induction:

Developmental stage:

Protein families:Fibroblast growth factor-binding protein family


   💬 WhatsApp