FGF9_HUMAN   P31371


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P31371

Recommended name:Fibroblast growth factor 9

EC number:

Alternative names:(FGF-9) (Glia-activating factor) (GAF) (Heparin-binding growth factor 9) (HBGF-9)

Cleaved into:

GeneID:2254

Gene names  (primary ):FGF9

Gene names  (synonym ):

Gene names  (ORF ):

Length:208

Mass:23441

Sequence:MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Tissue specificity:Glial cells.

Induction:

Developmental stage:

Protein families:Heparin-binding growth factors family


   💬 WhatsApp